SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|357418969|ref|YP_004931961.1| from Thermovirga lienii DSM 17291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357418969|ref|YP_004931961.1|
Domain Number 1 Region: 162-350
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.96e-55
Family Methylesterase CheB, C-terminal domain 0.0000151
Further Details:      
 
Domain Number 2 Region: 4-114
Classification Level Classification E-value
Superfamily CheY-like 4.7e-29
Family CheY-related 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|357418969|ref|YP_004931961.1|
Sequence length 351
Comment response regulator receiver modulated CheB methylesterase [Thermovirga lienii DSM 17291]
Sequence
MKTEKIKVLIVDDSALMRLILEDMLSSEEDIEVVGKARNGLDAIEKVKKLAPHVVTLDIE
MPVMDGITALRGILEANPTVKVIMFSTLTKRGADATIKCLELGAFDFVHKPSQSDKDEIQ
SVKTDLITKIRSAFMSLCSDKTLKLDQTYPKKVSKVPDEKGDYNLLLVASSTGGPQALMK
LLPQLPKNFPAPIAIVQHMPPGFTKSFSSRLDQLCNIHVVEGSENTPMTPGVAILAPGGQ
HMIIKETQGRMHCHLANLPPVNGVKPAADVLFQSVSLLENAKPVTVILTGMGKDGAKGAL
LLKEEKNSFVIAESPETAVIFGMPKAAGEVGAVDIFLLLDQIAPKITSLFQ
Download sequence
Identical sequences G7V5V9
WP_014162289.1.45467 gi|357418969|ref|YP_004931961.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]