SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|357419576|ref|YP_004932568.1| from Thermovirga lienii DSM 17291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357419576|ref|YP_004932568.1|
Domain Number 1 Region: 290-510
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.59e-39
Family ABC transporter ATPase domain-like 0.0002
Further Details:      
 
Domain Number 2 Region: 23-286
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.00000000000000144
Family DNA repair protein MutS, domain III 0.0084
Further Details:      
 
Domain Number 3 Region: 709-781
Classification Level Classification E-value
Superfamily SMR domain-like 0.000000051
Family Smr domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|357419576|ref|YP_004932568.1|
Sequence length 782
Comment MutS2 family protein [Thermovirga lienii DSM 17291]
Sequence
MKTDAKTLQLVDIPKVLELIEKECRSPLGVLCLREQEPLPSIQHVEERQALFVSFCKYED
VCGRLPWEKDLNPLGRLFEDAKVSGLLSGVELVHIRNMVGLAIRIKDVVSDRKDAFAELY
SLTRRIPDLSELFDDLHVLADDGRLYDRASELLGRLRSAHRDYAAKARKAAQNLVSNPSV
SSMLQDKNVHYRKGRIVLLVRQENLHKFRGIVIDRSSSGNSLYMEPEGLIEINNRVSILE
KEIEEEERRILRSLTRKVLMKQKLLERTEQVLGLLDLMYALREVARKDRWSLPLMKNSPM
LKLKGARHPLLGKQCVPIDIFCGTSFKQLIITGPNTGGKTVALKTVAVSLYLGWCGFPVP
CKEGTEIGDIDWMLADIGDEQSIEQNLSTFSAHLTRLIDMLQKANERSLFLLDELGAGTD
PQEGAALGIAILERFRSIGSLVIATTHHNSIKRYALSTKGVETASMEFDSETLKPTFRLL
MGMPGKSNALTIARHLGMPEEILSKAEEVLLESYYGEERLVDELHDKHMELDQLKKQLES
KEADLKRLKDELEREKRNLALEKGRIVSEAERKALEMIEEAQRLYHEMVKKIGFFNARNM
HKSTEKDRQRMLKMKKELLERQDVHDEKMEAEEISPGDLVEIIGQSTKGTVEAIEEGKAV
LLCGPIKVEVQLNKLKLVKKKEEVERTAVQGPIVKGDFKKVSVPPSIMIRGMTVDEAIPE
VELYLDRAFRAGYGEVTIIHGRGEGILRREVHALCKRLPYVTNFRLGEPSEGGIGVTIVS
FR
Download sequence
Identical sequences G7V9A2
gi|357419576|ref|YP_004932568.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]