SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|357419712|ref|YP_004932704.1| from Thermovirga lienii DSM 17291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357419712|ref|YP_004932704.1|
Domain Number 1 Region: 266-558
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 2.09e-80
Family DNA repair protein MutS, domain III 0.00000315
Further Details:      
 
Domain Number 2 Region: 559-795
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.9e-60
Family ABC transporter ATPase domain-like 0.000000945
Further Details:      
 
Domain Number 3 Region: 5-114
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 1.83e-38
Family DNA repair protein MutS, domain I 0.0000237
Further Details:      
 
Domain Number 4 Region: 125-277
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 2.49e-21
Family DNA repair protein MutS, domain II 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|357419712|ref|YP_004932704.1|
Sequence length 862
Comment DNA mismatch repair protein MutS [Thermovirga lienii DSM 17291]
Sequence
MSVPKGVKLTPMLKQYDYWKRQYPDCLLFFRMGDFYEMFFEDAQKASSILGIALTARDSA
REIPMAGVPYHAAENYIYRLIKAGFKVAICEQVTEPDGKNLVERKVVRVITPGTFVPADL
PMESKLAAVRIKDKVMYLALLNCSSGRLEAATLPEEDGLGLLCSFAPSELVIPKNLKEDT
RKKLLQFMEPRIVEKDPDDFDPKEGARRFCSEWGIATLEGFGFQEDDGSIGAAWAAYSYL
RETQFGVVKHIKRIHKSHFSSELIMDYSTQKNLELIEGDKLTLFSVLNRCGTPMGKRLLK
EWLLHPLVDHEQIRKRHDGVEKLLQNWTELQRLREVLSSCGDAEKALSRLGMGLGAPRDL
GVIRDTLGVLPGVMEVVRGAFIDEVLDIPGDPRDLRAKLESALCDELPKNIKDGNVIREG
FDQELDSLRYLRSHSGEELNAILEREREKTGIKNMKIGFNKVFGYYLEISKSYLDKVPQN
YIRKQTLVGGERFITEELKELEEKLMTLDIQIEAREKVLYESLVQEVLENSSTIQDISDF
IATLDVLCSFAVKARECNYVRPAINDGYVIALRDARHPVVEEALGSRAPFTPNDVLLDSY
GKRIAIVTGPNMAGKSTYLRMAALLVIMAQAGSFVPASKAEIGIIDRIFSRIGAKDELAR
GKSTFMVEMVETANILRNVTPRSLVILDEIGRGTSTYDGISIAWAVLEYLHKVCDGMPKV
LFATHYHELASLADSLPGLFNLSLAVEETEKGIVFLYKLEPQPADKSYGVEVAKLAGVPE
AVIKRSMELLRRFEEERNFKELGGEGQVDNGVKVKQLGLFLPEAEDLVRDIASLDPDNLT
PLGALELLYKLKDRAKEIIGEN
Download sequence
Identical sequences G7V9Q7
gi|357419712|ref|YP_004932704.1| WP_014163026.1.45467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]