SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|145294501|ref|YP_001137322.1| from Corynebacterium glutamicum R

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145294501|ref|YP_001137322.1|
Domain Number 1 Region: 107-304
Classification Level Classification E-value
Superfamily Formyltransferase 1.83e-58
Family Formyltransferase 0.00031
Further Details:      
 
Domain Number 2 Region: 20-101
Classification Level Classification E-value
Superfamily ACT-like 0.000000000000121
Family Glycine cleavage system transcriptional repressor 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|145294501|ref|YP_001137322.1|
Sequence length 304
Comment formyltetrahydrofolate deformylase [Corynebacterium glutamicum R]
Sequence
MTPSSPEVRNRPSTAPEERQFVLTFGCPDSTGIVAKLSSFLAERGGWITEAGYFTDPDSN
WFFTRQAIRAESIDTTIEQLREEFAPLAEEFGPRAKWSFTDTAQVKKAVLLVSKEGHCLH
DLLGRVAENDYPMEVVAVVGNHENLRYIAENHNVPFFHVPFPKDAVGKRKAFDQVAEIVN
GYDPDAIVLARFMQILPPDLCEMWAGRVLNIHHSFLPSFMGARPYHQAYSRGVKLIGATC
HYATGDLDDGPIIEQDVIRVTHKDTPTEMQRLGRDAEKQVLARGLRFHLEDRVLVYGNRT
VVFD
Download sequence
Identical sequences A0A0U4IP77 A4QB23
340322.cgR_0456 gi|145294501|ref|YP_001137322.1| WP_011896668.1.22635 WP_011896668.1.2455 WP_011896668.1.31689 WP_011896668.1.50302 WP_011896668.1.61613 WP_011896668.1.71482 WP_011896668.1.91554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]