SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145295031|ref|YP_001137852.1| from Corynebacterium glutamicum R

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145295031|ref|YP_001137852.1|
Domain Number 1 Region: 22-197
Classification Level Classification E-value
Superfamily Formyltransferase 4.84e-50
Family Formyltransferase 0.0000478
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|145295031|ref|YP_001137852.1|
Sequence length 210
Comment phosphoribosylglycinamide formyltransferase [Corynebacterium glutamicum R]
Sequence
MMVPRPKTVNISVVNSDSTTTIVVLASGTGTLLQSLIEAQGTYSIVGVVSDVECPALSRA
ADAGIDTAVVPLGKDRAQWNHELADAVAVSDPDLVVSAGFMKILGEGFLSRFPSRIINTH
PALLPSFPGAHAVRDALAYGVKVSGSTVHLVDAGVDTGPIIAQRAVPVEVNDDESSLHER
IKQVERKLIVEVLNSVEFSRQGGVQLNWRG
Download sequence
Identical sequences A0A0F6Z4W1 A0A0S2T3F5 A4QCK3
gi|62389750|ref|YP_225152.1| 196627.cg0983 340322.cgR_0975 gi|62389750|ref|YP_225152.1| gi|145295031|ref|YP_001137852.1| gi|62389750|ref|YP_225152.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]