SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145295350|ref|YP_001138171.1| from Corynebacterium glutamicum R

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145295350|ref|YP_001138171.1|
Domain Number 1 Region: 2-318
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 3.92e-77
Family ATP synthase (F1-ATPase), gamma subunit 0.0000304
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|145295350|ref|YP_001138171.1|
Sequence length 325
Comment F0F1 ATP synthase subunit gamma [Corynebacterium glutamicum R]
Sequence
MATIRELRDRIRSVNSTKKITKAQELIATSRITKAQGRVAAAAPYAEEIQRVLERLASAS
SLDHPMLREREGGKRAAVLVVTSDRGMAGGYNHNVLKKAAELEKLLAESGYEVVRYVTGK
KGVDYYKFRAEDVAGAWTGFSQDPDWAATHNVRRHLIDGFTASSEGEAAWREGLNLSEGQ
DIQGFDQVHVVYTEFISMLTQNPVVHQLLPVEPVIEDEIFEKGEDLLSSSGDVEPDYEFE
PDADTLLEALLPQYVSRRLFSIFLEAAAAESASRRNAMKSATDNASELVKDLSRVANQAR
QAQITQEITEIVGGAGALADSGESD
Download sequence
Identical sequences A0A1Q6BRG6 A4QDH2 R0JMY2
gi|511053900|ref|YP_008066083.1| gi|145295350|ref|YP_001138171.1| 340322.cgR_1289 gi|511057136|ref|YP_008069106.1| WP_003854841.1.2455 WP_003854841.1.25105 WP_003854841.1.26819 WP_003854841.1.41510 WP_003854841.1.48607 WP_003854841.1.56182 WP_003854841.1.7133 WP_003854841.1.71482 WP_003854841.1.83612 WP_003854841.1.99758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]