SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|145296970|ref|YP_001139791.1| from Corynebacterium glutamicum R

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145296970|ref|YP_001139791.1|
Domain Number 1 Region: 61-149
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 6.02e-22
Family Ribosomal protein L9 C-domain 0.00055
Further Details:      
 
Domain Number 2 Region: 1-57
Classification Level Classification E-value
Superfamily L9 N-domain-like 3.31e-17
Family Ribosomal protein L9 N-domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|145296970|ref|YP_001139791.1|
Sequence length 150
Comment 50S ribosomal protein L9 [Corynebacterium glutamicum R]
Sequence
MKLILTAAVENLGVAGDIVEVKNGYGRNLLLPRGLAIVATPGAEKQIEGIKRAQEAREIR
DLDHAREVKAALEALEGVTIAVRTSESGKLFGSVKTDDIVDAVKAAGGPNLDKRAIVLPK
NLVKTTGKYQVEAKLTDGIVSRVKFEVVAA
Download sequence
Identical sequences A0A0S2T8B9 A4QI23 R0JJF8
WP_003855068.1.10402 WP_003855068.1.16698 WP_003855068.1.22635 WP_003855068.1.24504 WP_003855068.1.2455 WP_003855068.1.25105 WP_003855068.1.26819 WP_003855068.1.31689 WP_003855068.1.41510 WP_003855068.1.45669 WP_003855068.1.48607 WP_003855068.1.50302 WP_003855068.1.54841 WP_003855068.1.56182 WP_003855068.1.57609 WP_003855068.1.61613 WP_003855068.1.7133 WP_003855068.1.71482 WP_003855068.1.81265 WP_003855068.1.81948 WP_003855068.1.83612 WP_003855068.1.91554 WP_003855068.1.9512 WP_003855068.1.99758 gi|511055439|ref|YP_008067622.1| 340322.cgR_2869 gi|511058677|ref|YP_008070647.1| gi|145296970|ref|YP_001139791.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]