SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148825788|ref|YP_001290541.1| from Haemophilus influenzae PittEE

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148825788|ref|YP_001290541.1|
Domain Number 1 Region: 5-150
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 2.88e-51
Family Molybdopterin synthase subunit MoaE 0.00000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148825788|ref|YP_001290541.1|
Sequence length 150
Comment molybdopterin converting factor subunit 2 [Haemophilus influenzae PittEE]
Sequence
MTDIQIAVQEQSFDQNAVYQWLSELHSVGATVIFVGKVRDLNLGNAVSSLYLEHYPAMTE
KALNEIVAQAKARWDIQRVSVIHRVGLLQTGDEIVLVGVSSAHRGDAYHANEFIMDFLKS
KAPFWKKEQTNQGERWIEARESDKEALEKW
Download sequence
Identical sequences WP_011961873.1.23065 WP_011961873.1.61426 WP_011961873.1.75514 gi|148825788|ref|YP_001290541.1| 374930.CGSHiEE_03695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]