SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145221663|ref|YP_001132341.1| from Mycobacterium gilvum PYR-GCK

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145221663|ref|YP_001132341.1|
Domain Number 1 Region: 66-245
Classification Level Classification E-value
Superfamily Rhomboid-like 1.18e-42
Family Rhomboid-like 0.0013
Further Details:      
 
Domain Number 2 Region: 5-48
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000229
Family B-box zinc-binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|145221663|ref|YP_001132341.1|
Sequence length 279
Comment rhomboid family protein [Mycobacterium gilvum PYR-GCK]
Sequence
MSSPYPYPAQQIPTCYRHPDRQTYVRCTRCNRFICPECMRDAAVGHQCIDCVGEGMRSVR
PVKTLTPVVTYALIGINLLAFALQMASPGLQRAFGLWSPAVADGEMYRLLTSAFLHFGLT
HLAFNMLALYFVGPPLEAALGRARFITLYLVSALGGSVLVYLLTLNALTAGASGAVFGLF
GATFVVGRKLNMDVRSVMAIIVLNLAFTFLIPLFTSQNISWQGHIGGLVTGALVAAAFAY
APRAQRTLIQAGAVGAILVVFVGLIVWRTAELRTLMGLG
Download sequence
Identical sequences A4T444
350054.Mflv_1071 WP_011891970.1.11461 gi|145221663|ref|YP_001132341.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]