SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145222464|ref|YP_001133142.1| from Mycobacterium gilvum PYR-GCK

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145222464|ref|YP_001133142.1|
Domain Number 1 Region: 23-216
Classification Level Classification E-value
Superfamily Formyltransferase 1.28e-54
Family Formyltransferase 0.000031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|145222464|ref|YP_001133142.1|
Sequence length 218
Comment phosphoribosylglycinamide formyltransferase [Mycobacterium gilvum PYR-GCK]
Sequence
MQSEAGGGEQQFHLRVPPSAPARVVVLASGAGSLLASLLSSAVGDFPARVVAVGTDRPCA
ALDIAAKADVPTFTVALTDHPDRTAWDAAITEATAAHAPDIVVAAGFMKILGAGFLSRFP
GRVLNSHPALLPAFPGAHAVRDALAYGVRVTGCTVHLVDAGTDTGPIVAQQAVAVYDDDD
ESALHERIKVIERRLLVDVVAAVASRGVTWTGRKATLG
Download sequence
Identical sequences A4T6V3 E6TI06
WP_011892765.1.11461 WP_011892765.1.22401 gi|145222464|ref|YP_001133142.1| 350054.Mflv_1874 gi|315442909|ref|YP_004075788.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]