SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145224312|ref|YP_001134990.1| from Mycobacterium gilvum PYR-GCK

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145224312|ref|YP_001134990.1|
Domain Number 1 Region: 1-205
Classification Level Classification E-value
Superfamily Formyltransferase 2.88e-54
Family Formyltransferase 0.0000122
Further Details:      
 
Domain Number 2 Region: 207-302
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 3.45e-25
Family Post formyltransferase domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|145224312|ref|YP_001134990.1|
Sequence length 310
Comment methionyl-tRNA formyltransferase [Mycobacterium gilvum PYR-GCK]
Sequence
MRLVFAGTPEPALPSLQRLIDSARHDVIAVLTRPDAAAGRRGRPSPSPVAELAAAHGIPV
LKPPRPNSEEFVAELAALAPDCCAVVAYGALLREELLAVPALGWVNLHFSVLPAWRGAAP
VQAALAAGDEVTGATTFQIELSLDSGPVYGVVTETIRPTDTAGDLLGRLAESGAGLLEAT
MDGIEDGTLTAVPQPAEGVSIAPKVSVDDARIRWELPAHVVDRRIRSVTPNPGAWTMAGE
LRIKVGPVTVPDDGPKDLEPGEIRVGKKHVHVGTATDAVLLGTVQPPGKKSMNAADWARG
ARAEDIRRAR
Download sequence
Identical sequences A4TC02
350054.Mflv_3730 WP_011894582.1.11461 gi|145224312|ref|YP_001134990.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]