SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145224035|ref|YP_001134713.1| from Mycobacterium gilvum PYR-GCK

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145224035|ref|YP_001134713.1|
Domain Number 1 Region: 10-109
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000785
Family Anti-sigma factor antagonist SpoIIaa 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|145224035|ref|YP_001134713.1|
Sequence length 245
Comment anti-sigma-factor antagonist [Mycobacterium gilvum PYR-GCK]
Sequence
MQVSATPGPGGGTALTITGTLDGSTYHEVRDSIIKAALEEPDAVIVDVSGLEVPSESAWK
AITSAHWHVRRWPHVPILLVCDEPARRAAITRSGVTRHVRLHPDHTSAARCVAAPTWMRR
RADVELDAGADCLQVMREVLARRLSEWGRPDMTLAASTVATVLVENVLEHTESRPTLIVE
TAGDFVAVAVSDENRIPPARREDPGTGAHTVSDLAIVTALSHAWGCTPTTTGKTVWALLA
PENQF
Download sequence
Identical sequences A4TA34
WP_011894309.1.11461 350054.Mflv_3450 gi|145224035|ref|YP_001134713.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]