SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113473954|ref|YP_720015.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113473954|ref|YP_720015.1|
Domain Number 1 Region: 7-45
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000196
Family Rho termination factor, N-terminal domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113473954|ref|YP_720015.1|
Sequence length 731
Comment Rho termination factor-like protein [Trichodesmium erythraeum IMS101]
Sequence
MVQERPPLEEMTLRQLRKVASELGISRYSRMRKAQLLAAVIEAQGMNNLSSAPLSKLEVQ
ERAEAKKFESGEENNIDDFFSSVDEGLTDLPNGYAKSKIVLMPRDPEWAYAYWDISNELK
EELRSQGGQQLALRTYDVTDINLDSQSPHSIQEYPCDELAREWYIPIPVSDRNYTVEIGY
RCADGRWLVLSRSEEVNIPPVYPSDWIDEQFITVSWDEDLRGKTFMELFPASRQITFHDN
HDDIYQGMFGIAEAEDKRVSGSMFGSVQMVPGSGQMIEETLSSYAMVSGLGMWASGSNVS
CGNQMMSGVGQTMSGVGLNASGVGLTASGVGLTASGVGLTASGVGLNASGVGLTASGVGL
NASGVGLTASGVGLNASGVGLTASGVGLNASGVGLTASGVGLNASGVGLTASGVGLNASG
VGLTASGVGLNASGVGLTASGMGMNMSGVGLTASGMGMNMSGVGLTASGVGMNMSGVGLT
ASGMGMNMSGVGLTASGMGMNMSGVGLTASGMGMNMSGVGLTASGMGMNMSGVGLTASGM
GMNMSGVGLTASGMGMNMSGVGLTASGMGMNMSGVGLTASGMGMNMSGVGLTASGMGMNM
SGVGLTASGMGMNMSGVGLTASGMGMNMSGIAGSIPPIRPRKFWLVADAELIIHGATEPD
ATVTIGGRPIKLNPDGTFRFQMAFPDGLIDYPIMAVAVDGEQNRSIHMQFTRETPERHTN
KKEEAILEWMS
Download sequence
Identical sequences Q11AD2
WP_011609946.1.43450 203124.Tery_0018 gi|113473954|ref|YP_720015.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]