SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113473972|ref|YP_720033.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113473972|ref|YP_720033.1|
Domain Number 1 Region: 14-410
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 1.66e-134
Family ArgJ-like 0.000000769
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113473972|ref|YP_720033.1|
Sequence length 413
Comment bifunctional ornithine acetyltransferase/N-acetylglutamate synthase [Trichodesmium erythraeum IMS101]
Sequence
MSDWQVITGGVTAPKGYQATGITAGLKPSGAEDLALILSNVDAIAAGVFTTTQVRAACVD
YCRQCLENKPSARAILCNAGQANAATGDLGWQDAVESAKELGKALNISPELILLASTGVI
GQRIKMDALKAAIPKLVSTVSQEGGEAAAKAIVTTDLVTKSIALETLMGDRVVRIGGIAK
GSGMIHPNMATMLSFITCDAAVSPQLWQDMLTTAVNRSFNQITVDGDTSTNDTVIALANG
QSRTSAITNMGAEAKKLEAMLTEVCIYLAKAIARDGEGATCLIEVQVTGTSNEVSANKIA
KTIAGSSLVKSAIFGRDPNWGRIAAAAGRAGVKFDHKELQVKLGDILLMENGQPLDFDLA
AAREYLKQRAAGKYLLDDTVLITVKVGDGVGSGKAWGCDLSYDYVKINAEYTT
Download sequence
Identical sequences Q11AB4
gi|113473972|ref|YP_720033.1| 203124.Tery_0043 WP_011609962.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]