SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113474187|ref|YP_720248.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474187|ref|YP_720248.1|
Domain Number 1 Region: 220-463
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.51e-68
Family Leukotriene A4 hydrolase catalytic domain 0.0018
Further Details:      
 
Domain Number 2 Region: 20-212
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 3.79e-46
Family Leukotriene A4 hydrolase N-terminal domain 0.00051
Further Details:      
 
Domain Number 3 Region: 559-852
Classification Level Classification E-value
Superfamily ARM repeat 4.93e-24
Family Leucine-rich repeat variant 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113474187|ref|YP_720248.1|
Sequence length 866
Comment peptidase M1, membrane alanine aminopeptidase [Trichodesmium erythraeum IMS101]
Sequence
MSSIYSEIENNSKSFELPGARPHYNPDRPGQVEHIFLNLELDIPNKSFQGICIISLNPIR
SGIDKLTIDAVNLEIKSVKIENIEQTFDYDGKQLEIYLQVPTTVGQLVKVAITYSANNPQ
RGIYFIAPDEHYPDKPTQVWTQGEDEDSRFWFPCFDYPGQLSTSEIRVKVPNKFIAISNG
ELIHTEESEDNKIYHWIQKQVHPTYLMTLAVGKFAEIQDEWNGIPVTYYVEKKYQDHARR
TMGKTPQMIEFFSQQFGYKYPYPKYAQVCVNDFIFGGMENTSTTLLTDRCLLDKKAALDN
RSSESIVAHELAHQWFGDLIVIKHWSHAWIKEGMASYSEVLWTANEYGQDEAAYYLLKEA
RSYIVEDKGRYRRPIVTNIYREAIELYDRHLYEKGACVYHMIKTELGAELFTKAIHDFVQ
GNAHKTVETIDLLRAIEQTTGRNLLSLFDQYVFRGGHPDYKVNYAWDGNSKLAKITVTQI
LPKNDKNGDVSKGLFDLKIPIAFGYIQAEKPELINFTVRIHEQEQTFYFPLSEKPKFISF
DVGNNYLKTVKLEYPLAELKAQLEFDPDPISRIYAAEALVKKGGLEVVKALSQALISEPF
WGVRVEVAKQLGKIKLDQVFDGLAISLKDEDPRVRRAVVEALTQVKTHKSYKLLKYLVKN
GDPSYYVEAIAVSGIGDIAAAHANSDEKPTEEKAIKLLKWVLQNKQGWNEVVRAGAISGL
SKMKTSKTALNLILKYTVPGVPQGLRLNAIRVLGTISTAQPPVNLERILQRLTELSRETF
FLTQVSVVAALSQMQTSRAIEILQNLANQTPDGRVRRRAEEAVQKVQKNIGSDKGIKQLR
DELDKVKKENQELRSRLENLEAKAKV
Download sequence
Identical sequences Q119P9
203124.Tery_0295 WP_011610171.1.43450 gi|113474187|ref|YP_720248.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]