SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113474205|ref|YP_720266.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474205|ref|YP_720266.1|
Domain Number 1 Region: 149-456
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 5.89e-85
Family NadC C-terminal domain-like 0.0000942
Further Details:      
 
Domain Number 2 Region: 15-148
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 7.51e-42
Family NadC N-terminal domain-like 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113474205|ref|YP_720266.1|
Sequence length 459
Comment nicotinate phosphoribosyltransferase [Trichodesmium erythraeum IMS101]
Sequence
MVQEYLELSLSPEDYTLLTDLYQLTMIACYVGEKIDQRQASFELFVRKLPTGFGYLIAMG
LAQALDYLEKFRFSSEQIDALKSTGIFANAPSEFWSLLAEAKFTGNVWAVKEGTAIFPNQ
PLLRIEAPLWQGQLVETYLLNTMNYQTLIATKAARMRDIAGNSTKLLEFGTRRAFSPQAS
VLAARAALAGGMDATSNVLAALKLGRKPVGTMAHSLVMAISAVEGSEEDAFKSFQRYFPT
ATLLIDTYDTLSATRLLARRVKQGEMQISGVRLDSGNLVELSQKVRSLLPKVRIFASGDI
DEWEIARLQKENACIDGYGIGTKLVTGVPVNGVYKLVEIDGIPAMKNTTGKVSYPGRKQI
YRYLENGQLKQDYLGLMAEDVLSQTEPHTDSFVKLMIQVVKNGEMLQTSESLEAIAKRTA
ISVASLPPETRSLENPILPPMKISHKLQQLTQKTQANSS
Download sequence
Identical sequences Q119N1
203124.Tery_0318 gi|113474205|ref|YP_720266.1| WP_011610189.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]