SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113474297|ref|YP_720358.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474297|ref|YP_720358.1|
Domain Number 1 Region: 831-1154,1209-1385
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 5.49e-82
Family B12-dependent (class II) ribonucleotide reductase 0.026
Further Details:      
 
Domain Number 2 Region: 1735-1980
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 2.26e-56
Family B12-dependent (class II) ribonucleotide reductase 0.0069
Further Details:      
 
Domain Number 3 Region: 547-667,856-920
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 3.45e-40
Family Intein (protein splicing domain) 0.0068
Further Details:      
 
Domain Number 4 Region: 293-499,531-598
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 1.37e-37
Family B12-dependent (class II) ribonucleotide reductase 0.014
Further Details:      
 
Domain Number 5 Region: 22-157,353-415
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 5.89e-30
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.017
Further Details:      
 
Domain Number 6 Region: 1383-1485,1520-1536,1682-1764
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 3.73e-18
Family Intein (protein splicing domain) 0.083
Further Details:      
 
Domain Number 7 Region: 1609-1715
Classification Level Classification E-value
Superfamily Homing endonucleases 8.5e-17
Family Intein endonuclease 0.013
Further Details:      
 
Domain Number 8 Region: 747-865
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000000000102
Family Intein endonuclease 0.039
Further Details:      
 
Domain Number 9 Region: 231-288
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000000000808
Family Intein endonuclease 0.044
Further Details:      
 
Weak hits

Sequence:  gi|113474297|ref|YP_720358.1|
Domain Number - Region: 147-212
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00258
Family Intein endonuclease 0.091
Further Details:      
 
Domain Number - Region: 1515-1587
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00974
Family Intein endonuclease 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113474297|ref|YP_720358.1|
Sequence length 1985
Comment hypothetical protein Tery_0425 [Trichodesmium erythraeum IMS101]
Sequence
MECCLLIDEAAVTIVAGNIRRCLPEGALVHTASGLVAIEKIRIGDRVLTSQGFYPVTNFF
DQGIQSLCRIQTEDGYFECTPDHKVAVLQDLYGNYKMIKAKDLQEGDRLIFVPQAIPGTP
TELPELKAVPSSEAKLITIPALQSEVAYFLGYLSGNGSVGSDGGQVRFRVSQDSPEILER
LINVAQEFGLETHRLRTLEQFQTQAYELELNSSTLNKYLSQFKQPSNSVCIPECILMGTT
EIRQAYLAGLVDADGCHSQGILLTSVDQGFLRQVQALYASLGITTRLCGSVQKPTGTWEG
ELVTVSEGGYEAVEKLMMNYSTQFPVQKPNHLKFFPDQGFPKEMVRPLVKTSQDHLGKVH
KQMIFPSVKKFVVDATDLIPVKVKKVEMDVREASTYDIEVASIHEFVCQGILVSNSAGIR
QGSNSDHIFTVAKDNLWRQDENGNWGIDPKRDALRMANHTHVFHYKPTLEECVEAVRKQF
YSGEGAIQWAGEAVARANRDLLFTPEIKSDFLKAYEKNNAKKWFQEHYPNITNDELEHRL
ARLGLNPCHSGDTLVSTDQGLIAIQDLVGKQFQALVDLRSIGLSGVRLTDAIAFATGVKT
TYQVILNNGMQMRCTGDHQHFTSRGWVSTRDLTDDDNIYIQGGAGQFGKGTISVAQAQML
GWWYRDGYNVKIKARSHSHGGKQDYFATGFVFDQDDYETAYNVVEKAVASITEREYVTKL
HKGVYEFPTQYPKLEKFFADLGIVGKEELPNNFLSQSQEVLIGFLQGIFSADGIVYEDSR
RIKLTMVSEKLLQQIQLILSNLGIISTVGLVREKDYIGVPYRTVNVTHEVSLCRGSYELL
ISSFSFSLFQQLIGFPLSPSKNVKAEKLLVQTLANYSESTINSKFISKVKKVEEFGEEVV
YDLHVPLTNSFIANGCLTHNCGEIIGSNFHCVSGDTLLITRDSIHKIKDVVGQKIEIWNG
KNWSQVIPLKTGKDRKLYRVRFGDGSYLDVTEYHRFFVKDRFGKKYEEVQTKDLLTHSKY
ALDVEPFIIDYHDGDSINLSYAYTLGAALGNGTIDQNSNGKIRVYSHKAELIFAGNKSLE
RQYNYLPSFVDVIDLGFSGELLRRLQTEPDALNTIASWNKSAILAFIAGLADTDGSETKG
NGIKISVSDYERAKRLQLLLTKCGIRASVNLMASRGCTTNLGERNQDLYYLQITDCREIP
CQRLDTTKVCEAKFQGKYQTIQNVEELPGLHDTYCFEEPEFHKGVFGNALTGNCNLSEIH
LNQIEPNNYKEQEEAFTAGALSVATLLKHEFLEPRYRYSRELDPIVGVSFTGLFDFFVKA
FGIEWLRWWQAGRPATAQGLEFKQQEAKYLTRWREIVHRVVWDYCDRHNLKRPNRCTTVQ
PSGCLDKTALRIFNQGLLYADEVVTPGSGETVGLGLTVRNGIGASTAIANQPMELVEIKL
ANGRKLRMTPNHRMSVKGKWIHACNLKPGMLLDYSIGEYQKREDTLLIPLQLEDYTEVNN
SQTLGHNGGVLTKKIMTPASMTSDLAYFLGCLFGNGCIVQNKYQVCFYHSRLDVLYGLQE
KGKKLFGIKGSLNDFANGRFELCFASRQLFYWLHLNQLVKTQKSEDLERIPLSLRRSSRV
TLLSFFCGLIDTNGYVPQDGKLSIASASSDFIHNLQQIGESIGLCFSIYQNTKGENLQNQ
HNNTWGLCLSPMLSNVDALDYLNHNSIKCQEGPVVISKCVLNYSPYKIESVNIGAVCDYS
YDFAIEGINDNDSWYWQGALKSHNTKSLLTNASPGWHPPFGLRWVRRITFAKNDPVALAC
LDYGYSVIPGQSGKDENGNLLNDPFDERAKEWLVEIPVQVSWIDLPGVEEIAIEKFSATA
MFDFYMEVQKNWTTHNSSSTILLTEAEIEPLGKRIYEAIRDDEGYISSALLARFDAPFPR
LPFEHISKDQYEKMQEDVLQRRKSHNFSELMNGYVLASELPETGPQDPACSGMVCELKGL
EPEIH
Download sequence
Identical sequences Q119D9
203124.Tery_0425 gi|113474297|ref|YP_720358.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]