SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113474316|ref|YP_720377.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474316|ref|YP_720377.1|
Domain Number 1 Region: 28-314
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.28e-83
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000174
Further Details:      
 
Domain Number 2 Region: 299-404
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 4.06e-16
Family Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113474316|ref|YP_720377.1|
Sequence length 405
Comment tyrosyl-tRNA synthetase [Trichodesmium erythraeum IMS101]
Sequence
MMTDKFTWLHRGISEIFPDQPYSQDPNENLILKLTTLDRPLRVKLGIDPTGVDVHLGHSI
PVRKLRAFQDAGHTAVLIIGDFTARVGDPTGKSEARRQLTPEQVQENAKTYLDQVRPILD
FDTPGRLEIRYNSEWLSKLDLADILELLATMTVGQMLAKEGFALRYQQENPIYIHEFLYP
LMQGYDSVAVDADVELGGTDQKFNIAVGRDLQRHFGKRTQFGLLMPILLGTDGVQKMSKS
LGNYVGLSEDPLSMYSKLEKIPDDQVENYFELLTNLNINDIDKNPRERQKLLALDIVSQY
HSQEAALEAQQTAVKMVIKGDMSQTEAVPEFSLASVEFPAKLFYVVSASGLCKSSSEARK
KIAGGAVRLDDERISDQNFTLDSPADLDGKVLRVGKKNFVRLVKN
Download sequence
Identical sequences Q119C0
203124.Tery_0445 gi|113474316|ref|YP_720377.1| WP_011610300.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]