SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113474404|ref|YP_720465.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|113474404|ref|YP_720465.1|
Domain Number - Region: 2-35
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0578
Family Transcriptional factor domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113474404|ref|YP_720465.1|
Sequence length 56
Comment putative transposase [Trichodesmium erythraeum IMS101]
Sequence
MDCTYCQSHKVVKNGHRQGKQSYLCRECGRQFRDGPCPAGYSSDVKELCVKMSLNA
Download sequence
Identical sequences Q118T2
203124.Tery_0542 gi|113474404|ref|YP_720465.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]