SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113474408|ref|YP_720469.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474408|ref|YP_720469.1|
Domain Number 1 Region: 561-1044
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 9.01e-133
Family DNA polymerase I 0.0000000214
Further Details:      
 
Domain Number 2 Region: 8-155
Classification Level Classification E-value
Superfamily PIN domain-like 1.07e-44
Family 5' to 3' exonuclease catalytic domain 0.0000547
Further Details:      
 
Domain Number 3 Region: 360-547
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.6e-43
Family DnaQ-like 3'-5' exonuclease 0.00015
Further Details:      
 
Domain Number 4 Region: 182-296
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 2.09e-27
Family 5' to 3' exonuclease, C-terminal subdomain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113474408|ref|YP_720469.1|
Sequence length 1045
Comment DNA polymerase I [Trichodesmium erythraeum IMS101]
Sequence
MVNHSPIALFVDGHSLAFRSYYAFAKSRNGGLKTSTGIPTSICFGFLKSLLEVINTQKPE
YLAIAFDLGKPTFRHEADKNYKADRPEPPEDLIIDLGNLQDLLKAFNLTVITAPGYEADD
ILGTLAKKASATGFKVKILSGDQDLFQLIDAEKGISVLHLPGGKGSIPQEFFPEEVKEKL
GILPTQVVDYKALCGDKSDNIPGVRGIGQKTAVKLLNEYGCLSEIYASLEQIKGANKKKL
VLGKTEAEHSQFMAKIEVNVPLNIDIEDCKFKKIYPSEIEPILQKLELQHFINKIPHLEQ
QFNSLVEVKSGLDESGIQQQEISQNTLVEIGSDDWFFSAEDTKVAKQQTSTKSKIKPQIV
DTIEKLNKLVNILKEQKNPHIPVAWDTETTSLEPRDAELVGIGCCWGKNMEDVAYIPTGH
KTDKNLDKVTVLESLKPVLESSEYPKVFQNSKFDRLVFRCQGIKLTGVFFDTMLASYVLN
PEAKHSLEEIYIRYLRNVGINLQSYQDVVSKNQTIADLDILKVADYCGTQVWVTFQLVEK
LRTELEKADKNKSTEKSLYRLLVDVEQPLEPVLAEMEFQGIRIDIEYLKKFSVQLKEDLE
EIEKRAFKTVDSQVLQKYLQTEIHEIDFNSFSNQQELKKAISSPILKAYITKLLKEHRQN
LENIESQINQVETRDLLNLNSPSQLSELLFRILNQNHKKSRRIKTGYSTDVVALEKLQTE
PEHHPIIDEILNHRTLYKLFSTYVEAIPRLVRSDTQRVHTNFNQTQTDTGRLSSSEPNLQ
NIPIGTKFSRQIRQAFLPKKDWLLVAADYSQIELRILAHLSQEPVLIEAYKNNQDVHTVT
AKLLFEKEEISSEERRVGKTINFGVIYGMGAQKLARSVKITVKESKQFLEKYKQQYSLVF
AYLEKLKKQAIAKGYVETILGRRRYFELESKTIRDLKDKEPEEINLQELKFSQNDAQILR
SAANSPIQGSSADIIKIAMIRLNKILTNYQTKLLLQVHDELVFEVPPSELEKMQQLIKST
MENAVTLKVPLIVDIHGGKNWMETK
Download sequence
Identical sequences Q118S8
203124.Tery_0546 gi|113474408|ref|YP_720469.1| WP_011610390.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]