SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113474474|ref|YP_720535.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474474|ref|YP_720535.1|
Domain Number 1 Region: 448-725
Classification Level Classification E-value
Superfamily PP2C-like 6.41e-50
Family PP2C-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113474474|ref|YP_720535.1|
Sequence length 733
Comment putative protein serine/threonine phosphatase [Trichodesmium erythraeum IMS101]
Sequence
MLICPQCELENPDNHRYCQKCGVSLTHKNCHQCGSQVSLKALQCHNCGVYTGQVWKAIIY
YQKEVATPSIPEISVNNLSQQEFMTGEKPLDNDSLESATKIIGEESEKILESSHNLDEKI
KIEDDYQSNNTFGTSASDIEVEETQPKAIGNSDNSELTTTDILNLVCETVNTENQLSLND
TKILSTPSIEKYLDPKQRYQVLETIPVNNQGQRVVVEVLDRYPLEETPIRAWLKNNSDSF
KQITPKAMEALIIPIIAQPYIALQTQIPQNLPTIHDSWRSHSIERLRCHSKEILLLADYS
SWPRLVDLWGNQQLPQLQILSWLEQMTELWIALMPWDCCQSILEDENLRVNQVDNNYIKL
QSLYSKPGEPKTLEDLMLFWQRLFEQSQRTKFGWITALFQDWRNGEIQTIEQLRSYIMNT
QDNLQSQAPAKSAPTFLQADNSASKIPDDVETQETELLPTQLISLESSSKSDVGSQRDHN
EDAFGIQTQIESQETSIEKIIQAKGIYILCDGMGGHAGGEIASHLAVDSIKQYFQTESSW
SVGLPSEETIREAVLQANEVIYDLNQQEARSGSGRMGTTLVMAMIYDTEVAVAHVGDSRL
YRFSREGGLEQITLDHEVGQREVNRGVELQIAYGRPDAYQLTQALGPRNENFVRPDIQFL
NLKNDTLLILASDGLTDNQLLENNWQTHLKPLLDKQANLELGVSKLIDLANQYNGHDNIT
AIVIRALIKPEKD
Download sequence
Identical sequences Q118L2
203124.Tery_0619 WP_011610455.1.43450 gi|113474474|ref|YP_720535.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]