SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113474508|ref|YP_720569.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474508|ref|YP_720569.1|
Domain Number 1 Region: 214-544
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 2.09e-70
Family Integrin alpha N-terminal domain 0.0029
Further Details:      
 
Domain Number 2 Region: 552-661
Classification Level Classification E-value
Superfamily CalX-like 1.31e-29
Family CalX-beta domain 0.00098
Further Details:      
 
Domain Number 3 Region: 661-774
Classification Level Classification E-value
Superfamily CalX-like 1.96e-27
Family CalX-beta domain 0.0012
Further Details:      
 
Domain Number 4 Region: 776-887
Classification Level Classification E-value
Superfamily CalX-like 3.92e-27
Family CalX-beta domain 0.001
Further Details:      
 
Domain Number 5 Region: 888-1032
Classification Level Classification E-value
Superfamily CalX-like 5.1e-27
Family CalX-beta domain 0.00085
Further Details:      
 
Domain Number 6 Region: 1028-1110
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000536
Family Collagen-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113474508|ref|YP_720569.1|
Sequence length 1113
Comment Na-Ca exchanger/integrin-beta4 [Trichodesmium erythraeum IMS101]
Sequence
MTEPFEENNSSEPEFPDDPFPSVHYLPGADYSNPEVTDPMIQGAWGEVRDELADFILAPE
FDDYIKTAFGETVDPELAKEQIKDVLTGENLPEVIMLPAADMEPAVGAYDPLTGSIYLAD
SLLPDTDGVLVDVLLEELGHFLDSQLSESDSPGDEGELLAALVRGEELTQFQVMMLRGQD
DRVDIWVGGVEVEVEASEKVDFEKARNFKVGDIARSVAVGDFNGDGIPDLAVANFSSDNV
SVLSGKGDGSFGSATNFPVGDGPISVAVGDFNGDGIPDLAVANLWSDNVSVLSGKGDGSF
GSATNFPVGDGPISVAVGDFNGDGIPDLAVANDGSDNVSVLSGKGDGSFGSATSFPVGDG
PFSVAVGDFNGDGIPDLAVANRFVANLWSDNVSVLSGKGDGSFGSATSFPVGNGPWSVAA
EDLNGDGIPDLAVANFSSDNVSVLSGKGDGSFGSATNFPVGDRPWSVAAEDLNGDGIPDL
AVANIGSDNVSVLSGKGDGSFGSATNFPVGDGPISVAAEDLNGDGIPDLAVANFNSHNVS
ILINKTPITIIPNITISDTKLTEGNTNKTAKFTVTLDNPTTTTVKVNYTTANQTAKVNQD
YKLTKGTLTFQPGETNKNITVPILGDNRDEPQEKFRVALSSPQNANIKDGEATGTIVDND
PVPQISIGDAKVTEGNRGQKNIEFEVKLNNPSGKTVRVNYGTQEGSAKSGKDFRNKRGVL
TFQPGQTKKIVNIPILGDRVDENNEEFQVKLSRARNGKLSDKTAVGRIIDNDETLPQISI
RDAKVTEGNRGKKQMKFEVELNNPSTKTVRVNYATVDGSAKSGKDFQNKRGVVTFQPGQR
KKIVNIPIVGDRVDENNEQFQVKLSRARNGKLSDKTAVGRIIDNDETQISIRDAKITEGQ
QGEKNMKFEVKLDNSSSEVVKVNYETVDGSAKSGKDYLKKKGVLKFQPGETKKTVNVSIL
GDTVDEKDEKFQVKLSGAKNGKLSDAKAVGIIQNNSAPEDIKNPVDLGILSSEQTSRVDD
IGFATGPVDRNTEDYFSFEVEKEGLVSVFVDSFVQDLGIKLYDKDGSLLNQSNKEGFATE
KIQVILDPGVYYLKVFPVGSGRTDYNLSINIIN
Download sequence
Identical sequences Q118H8
203124.Tery_0657 gi|113474508|ref|YP_720569.1| WP_011610489.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]