SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113474564|ref|YP_720625.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|113474564|ref|YP_720625.1|
Domain Number - Region: 5-51
Classification Level Classification E-value
Superfamily PHP domain-like 0.00392
Family RNase P subunit p30 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113474564|ref|YP_720625.1|
Sequence length 68
Comment hypothetical protein Tery_0720 [Trichodesmium erythraeum IMS101]
Sequence
MMEPEAFHPSHSPTQVQNLKDLSKKYRLLIAGGIDYHGVNNYRKKETTLNMLPLPIELLA
PIQQAPSI
Download sequence
Identical sequences Q118C2
gi|113474564|ref|YP_720625.1| 203124.Tery_0720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]