SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113474567|ref|YP_720628.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474567|ref|YP_720628.1|
Domain Number 1 Region: 229-507
Classification Level Classification E-value
Superfamily Ribokinase-like 4.09e-56
Family YjeF C-terminal domain-like 0.0000458
Further Details:      
 
Domain Number 2 Region: 9-249
Classification Level Classification E-value
Superfamily YjeF N-terminal domain-like 6.28e-55
Family YjeF N-terminal domain-like 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113474567|ref|YP_720628.1|
Sequence length 511
Comment carbohydrate kinase [Trichodesmium erythraeum IMS101]
Sequence
MNNIKEKFIVTAAQMRQIEERIFIAGMPVAALMEKVAGLVTRKISELLNSNISKIGVLVG
PGHNGGDALVIARELYFQGYEIIVYCPFVNLKELTNAHAKYLQYLGVNFVKNISLLKNCA
LLIDGLFGFGLEREISGDLAESISQINSWQKQVFSIDLPSGIHTDTGEVLGTSICATYTF
CLGLWKQAFLQDKALKYFGKSELIDFDIPLADITEVLGEFPTIERITKTSALENLPLPRP
PATYKYTNGNLLLIVGSHRYSGAAVLTGLGSRVTGVGMLSIAVPKSIKPILNSHLPEALI
IGCPETETGTIKQLPEDIDLSKFEAIACGPGLTIEPTSIIEKVLSVNCPLVLDADALNIC
GNLANNSLVSQRQAPTIITPHPGEFKRLFPHLVDQLNNRILAAEKATKNSNVIIVLKGAK
TIIANSQKILINPESTPALARGGSGDVLTGLVGGLLAINSTQTLPFNAVKTAVWWHAQAA
ILAVKERTELGVDAFTLTQYLIPALKKYNFC
Download sequence
Identical sequences Q118B9
WP_011610548.1.43450 203124.Tery_0723 gi|113474567|ref|YP_720628.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]