SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113474573|ref|YP_720634.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474573|ref|YP_720634.1|
Domain Number 1 Region: 1-24
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 0.00000415
Family Ribosomal protein L32p 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113474573|ref|YP_720634.1|
Sequence length 58
Comment 50S ribosomal protein L32 [Trichodesmium erythraeum IMS101]
Sequence
MAVPKKRTSKSKKNMRKANWKNQAKLAAKKALSLGKSVETQRSHSFVHPRYEEEEEED
Download sequence
Identical sequences Q118B3
WP_011610554.1.43450 203124.Tery_0730 gi|113474573|ref|YP_720634.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]