SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113474583|ref|YP_720644.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474583|ref|YP_720644.1|
Domain Number 1 Region: 11-461
Classification Level Classification E-value
Superfamily L-aspartase-like 9.11e-145
Family L-aspartase/fumarase 0.00000000422
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113474583|ref|YP_720644.1|
Sequence length 463
Comment argininosuccinate lyase [Trichodesmium erythraeum IMS101]
Sequence
MKQDRQTWSQRFEKALHPMIARFNASISFDIELIEHDINGSVAHTKMLAKTGIISAEEGE
KLLTGLEQIRQEYITGNFHIVEDAEDVHFAVEKRLIEITGDVGKKLHTARSRNDQVGTDT
RLYLREKIEQIRFLLIKFQKVILELAESNIETLIPGYTHLQRAQPLSLAHHLLAYFHKAE
RDWERLGDVYRRVNISPLGCGALAGTTFPIDRHYTAELLGFEKPYANSLDGVSDRDFAIE
FLCAASIIMVHLSRLAEEIIVWSSEEFRFVTLTDVCSTGSSIMPQKKNPDVPELVRGKTG
RVFGHLQSMLVVMKGLPLAYNKDLQEDKEGLFDSIKTVKSCLEAMTILLEEGLEFNSDRL
TEAVAEDFSNATDVADYLAARGVPFREAYNLVGKVVKTCISGGKLLKDLTIKEWKELHPV
FASDIYEAITPYQVVSARNSYGGTGFKQVKTEIDVAKQKLAEK
Download sequence
Identical sequences Q118A3
WP_011610564.1.43450 gi|113474583|ref|YP_720644.1| 203124.Tery_0740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]