SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113474587|ref|YP_720648.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474587|ref|YP_720648.1|
Domain Number 1 Region: 1-99
Classification Level Classification E-value
Superfamily Urease, gamma-subunit 6.02e-46
Family Urease, gamma-subunit 0.000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113474587|ref|YP_720648.1|
Sequence length 108
Comment urease subunit gamma [Trichodesmium erythraeum IMS101]
Sequence
MQLSPQEKDKLMIFTAALLAEKRKEKGIKLNYPEAVAYISAAILEGAREGKTVAELMSYG
RTVLNQNEVMEGISEMIEEVQVEATFPDGTKLVTVHNPIIIKENDLAE
Download sequence
Identical sequences Q117Z9
203124.Tery_0746 2005264780 gi|113474587|ref|YP_720648.1| WP_011610568.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]