SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113474636|ref|YP_720697.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474636|ref|YP_720697.1|
Domain Number 1 Region: 299-361
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00000000000000589
Family Pentapeptide repeats 0.0062
Further Details:      
 
Weak hits

Sequence:  gi|113474636|ref|YP_720697.1|
Domain Number - Region: 83-187
Classification Level Classification E-value
Superfamily Cation efflux protein transmembrane domain-like 0.0131
Family Cation efflux protein transmembrane domain-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113474636|ref|YP_720697.1|
Sequence length 430
Comment pentapeptide repeat-containing protein [Trichodesmium erythraeum IMS101]
Sequence
MNNYSNFSPSNNPNSHSTLESPNGTPEAITSVKKLNFIDNEIEQMLPTPATPNTLVEHQK
SEGPKNPVASIVTLVAIALMILGLAIDNVLLGYTSAIIVILSSVKMIWPSWGKVWKTLIP
SVWRNLIIACFGLLAAIVGLLMLSGANQQPGSRNIHINWDAIGAVGELIGALGQILIAII
AVYVAWRQYVISKDLTIQQNRITQQQTIDAYFQGVSDLAMDEKGFLEDWPQERAIAEGRT
AAIIKSVDEEGKAKILRFLSQSRLVTPIKRDRLLGRPIFDGQGGYAEDREHGTRVIDLGV
MLAGADLKNTDLRWTELSDANLVRANLSGCDLVKANFSRTILYEASLVGADLRGVRFFYG
TAEYATPRSRTHIPNYQTGAYTGAVVENVDFTEVKRLSDEQHYYCCAWSGERSRKTIPNG
CGGIPNKLGR
Download sequence
Identical sequences Q117V0
203124.Tery_0807 gi|113474636|ref|YP_720697.1| WP_011610616.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]