SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113474685|ref|YP_720746.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|113474685|ref|YP_720746.1|
Domain Number - Region: 14-72
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.000196
Family HEPN domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113474685|ref|YP_720746.1|
Sequence length 148
Comment hypothetical protein Tery_0868 [Trichodesmium erythraeum IMS101]
Sequence
MDNNSDTYGRTIYLGASRRRLEDAEALYNQERWNGAIYMGGYAIECALKSLLCHEEDIVN
FKKTKVFKRLKGSNLHDLEQLLEASYICKGVKDSKKDQSLKKAWDTVKLWQNDKLRYSDK
KGDKIEASKFIYAVKILHGYFLAKLQAY
Download sequence
Identical sequences Q117Q1
203124.Tery_0868 WP_011610664.1.43450 gi|113474685|ref|YP_720746.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]