SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113474757|ref|YP_720818.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474757|ref|YP_720818.1|
Domain Number 1 Region: 83-172,202-341
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.89e-46
Family RecA protein-like (ATPase-domain) 0.041
Further Details:      
 
Domain Number 2 Region: 310-324,358-504
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3e-35
Family ATP-dependent protease Lon (La), catalytic domain 0.015
Further Details:      
 
Weak hits

Sequence:  gi|113474757|ref|YP_720818.1|
Domain Number - Region: 5-33
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0226
Family Rubredoxin 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113474757|ref|YP_720818.1|
Sequence length 517
Comment DNA repair protein RadA [Trichodesmium erythraeum IMS101]
Sequence
MPKHKTKYVCRECGYESTQFLGRCPGCNTWNSLKEEIEQTTVTALQRLGITDIGIGSQAS
EGDDSSGQPRASFLLSQISDQTLSRMPSGFEELDRVLGGGIVPGSLVLIGGEPGIGKSTL
LLQVANQLSNRCRVLYVSAEESGQQVKLRSQRLIVNFNEAKVEHKDNVSNVEIDQDLSND
ENQENYGNSEPINDSTTDSMENLFLLPETDLEVILRELESLKPYLAVIDSIQTIYFASLT
SAPGSVAQVRECTSALMQVAKRENITLLIVGHVTKDGALAGPRVLEHLVDTVLYFEGDRF
ASHRLLRSMKNRFGATHEIGVFEMVANGLKEILNPSELFLGSRDEYSSGTSTVVSMEGTR
PIVVEIQALVSPASHGSPRRSTTGIDGSRLQQILAVLEKRVGIPLSKLDTYVATVGGLSV
EEPAADLGIAIAVVASFRDRVVDPRTVLLGEVGLGGQVRPVSQLELRLREAAKLGFKRAI
IPKGQQPMDLGMRILPIAKVIDAIIAAIPAQPPTMEN
Download sequence
Identical sequences Q117H9
gi|113474757|ref|YP_720818.1| 203124.Tery_0956 WP_011610733.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]