SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113474795|ref|YP_720856.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474795|ref|YP_720856.1|
Domain Number 1 Region: 12-198
Classification Level Classification E-value
Superfamily ITPase-like 4.45e-61
Family ITPase (Ham1) 0.00000974
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113474795|ref|YP_720856.1|
Sequence length 205
Comment RdgB/HAM1 family non-canonical purine NTP pyrophosphatase [Trichodesmium erythraeum IMS101]
Sequence
MKNFTPLKTTPRLLVVATGNLGKVVEMQEYMADLNLQLELKPKDLEIEETGKTFLANACL
KASEVAKVTEKWAIADDSGLAVDALDGKPGIYSARYAPTVAEQIERVLRELKDSQNRQAK
FVCALVIARPDGTIALKAEGICYGEILYSTRGNGGFGYDPIFYVPSEKKTFAEMSPETKR
SLSHRGKAFQILLPQIKEIFAIESV
Download sequence
Identical sequences Q117E1
WP_011610770.1.43450 gi|113474795|ref|YP_720856.1| 203124.Tery_1005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]