SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113474849|ref|YP_720910.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474849|ref|YP_720910.1|
Domain Number 1 Region: 134-309
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.09e-50
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000232
Further Details:      
 
Domain Number 2 Region: 389-501
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 4.58e-31
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000159
Further Details:      
 
Domain Number 3 Region: 5-131
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.74e-30
Family Duplicated SiR/NiR-like domains 1 and 3 0.00025
Further Details:      
 
Domain Number 4 Region: 304-373
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.16e-17
Family Duplicated SiR/NiR-like domains 1 and 3 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113474849|ref|YP_720910.1|
Sequence length 510
Comment ferredoxin-nitrite reductase [Trichodesmium erythraeum IMS101]
Sequence
MTETIQRKMKLNSFDKFKAEKDGLAVKTEIEHFAKIGWEAIDKTDRNHRLKWLGVFFRPV
TPGKFMLRMRMPNGMLSSQQMRVLAGIVQRYGDDGNADITTRQNLQLRGIAIEDIPDIFN
RLEKVGLTSVQSGMDNVRNITGSPVAGIDATELYDTRELIKQVQDMITDNNKGNFEFTNL
PRKFNIAIAGCRDNSVHAEINDIAFIPAYKNDKFGFNVLVGGFFSAKRCEAAIPLNAWVE
PNQVIALCRAILEVYRDYGLRENRQKSRLMWLIDEWGLTKFRSQVEKQIGLTLETEALKD
EILWEKRDHIGIYKQKQPGLNYIGLNIPVGRLYAVDMFDLARLAEVYGNGEIRLTVEQNV
IIPNVPDSRLETFRSEPLLKKFSFEPQPLTRAVVSCTGSQFCNFALIETKNRALAIAKEL
ETELSIPKPVRIHWTGCPNSCGQPQVADIGLMGTKVRKNGKMVDGVNLYMGGKVGKDAQL
GSCVQKSIPCEDLKPILRSLLIKNFAAQPK
Download sequence
Identical sequences Q116Y7 Q9RA39
203124.Tery_1068 gi|113474849|ref|YP_720910.1| WP_011610823.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]