SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113474872|ref|YP_720933.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474872|ref|YP_720933.1|
Domain Number 1 Region: 33-214
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 3.18e-44
Family Phosphoglucomutase, first 3 domains 0.00041
Further Details:      
 
Domain Number 2 Region: 292-399
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.02e-29
Family Phosphoglucomutase, first 3 domains 0.003
Further Details:      
 
Domain Number 3 Region: 192-289
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.96e-25
Family Phosphoglucomutase, first 3 domains 0.0011
Further Details:      
 
Domain Number 4 Region: 394-484
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 1.26e-19
Family Phosphoglucomutase, C-terminal domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113474872|ref|YP_720933.1|
Sequence length 489
Comment phosphoglucosamine mutase [Trichodesmium erythraeum IMS101]
Sequence
MVTTPSFKPTYEQNTFKLSPTATTTTLPWNNTSLPTTPLFGTDGIRGKAGELLTAPMALQ
IGFWAGQVLPQYCQNPGPIIMGQDTRNSGNMLAMALSAGLTAAGLEVWNLGLCPTPCVAY
ITSISEAIGGVMISASHNPPEDNGIKFFGSDGTKLSSELQQKIESGIRGTANFPTNHSNW
GQHYHRPELVKEYQASLHSPLTPGSLQGMKIVLDLAWGAAVHTAPEVFRGMGAEIICLHD
QPNGDRINVNCGSTHLSHLQQAVIEHNANLGFAFDGDADRVLAIDSQGRSIDGDYILYFW
GQSLSKARLLPNNLIVTTVMANLGFEHAWNKQGGKILRTKVGDQYVHAEMQRTGSMLGGE
QSGHVLCPHYGITGDGLMTALHLATLVKNSGISLAELVDQSFKTYPQLLRNVRVEDRDRR
ANWKNCEPLVKTIEEAETALADLGRVLVRASGTEPVIRVMVEAINLELAKSWTENIVLAV
QQHLLPTKD
Download sequence
Identical sequences Q116W4
WP_011610846.1.43450 gi|113474872|ref|YP_720933.1| 203124.Tery_1095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]