SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113474916|ref|YP_720977.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474916|ref|YP_720977.1|
Domain Number 1 Region: 104-381
Classification Level Classification E-value
Superfamily PLP-binding barrel 8.04e-66
Family Alanine racemase-like, N-terminal domain 0.0019
Further Details:      
 
Weak hits

Sequence:  gi|113474916|ref|YP_720977.1|
Domain Number - Region: 491-551
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.000732
Family Eukaryotic ODC-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113474916|ref|YP_720977.1|
Sequence length 693
Comment arginine decarboxylase [Trichodesmium erythraeum IMS101]
Sequence
MDLHSTINENSSQISNNTLLTNISQTDQTEINDIKSEQKKLWRIEDSEKLYKILGWGHPY
FSINSVGHVTVSPKGDLGGSLDLYELVESIKQRNIGLPLIIRFSDILEDRIERLNACFSK
AIARYKYKNIYRGVFPVKCNQNSHLVEEVVKFGKPHKFGLEAGSKPELLIAIATLNTTDG
LIICNGYKDREYIETAILAQRLGKIPIIVIEQVEEVQLVIEASRKLNIKPVVGIRVKLST
KGMGRWAGTTGDRAKFGLNIPEIIKVVNQLKSTGILDSLQLLHFHIGSQISSISVIKDAI
REASQIYVELAQLGANMKYLDVGGGLAVDYDGSKSNFYASKNYDMQNYANDIVAEVKEAC
EEKNILPPILISESGRAVASHQSVLVFDVLGVSQIPKEEPPVIGKGEHLILQNLYETYQS
INKDNYQEAYHDAIQFKEESISIFNFGYLSISERAKVEQLYWGCLRKIQEILKSSEYIPN
DLEELEKVMASIYYINLSVFQSAPDSWAINQLFPIMPIHRLDEEPTERVILADLTCDSDG
KIDRFIDLRDIKSLLELHPLQVSNKSSQYSPIQKLENSTTEIISVFEPYYLAMFLGGAYQ
EIMGNLHNLFGDVNVVHIKLNPSGYKIEHVVKGDTMTEVLNYVQYNSDDLVENIRCQTEQ
ALQEEKITLKESRMLLQNYESSLSSYTYLSLSN
Download sequence
Identical sequences Q116S0
gi|113474916|ref|YP_720977.1| 203124.Tery_1142 WP_011610890.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]