SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113474920|ref|YP_720981.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|113474920|ref|YP_720981.1|
Domain Number - Region: 76-102
Classification Level Classification E-value
Superfamily Tropomyosin 0.0085
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113474920|ref|YP_720981.1|
Sequence length 124
Comment hypothetical protein Tery_1146 [Trichodesmium erythraeum IMS101]
Sequence
MKQINFLLIFLVCLALVIFTLQNTQLTTVKLIEGIELEAPLSVELLIAIGLGAVLAWLFN
LWSRIQYTIESFRQMREISSRNKRIQELQEDVERYEEELKQRASLPVAETLSDLVKSTEA
EAPK
Download sequence
Identical sequences Q116R6
203124.Tery_1146 WP_011610894.1.43450 gi|113474920|ref|YP_720981.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]