SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113474961|ref|YP_721022.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474961|ref|YP_721022.1|
Domain Number 1 Region: 9-175
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000000000425
Family Transposase inhibitor (Tn5 transposase) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113474961|ref|YP_721022.1|
Sequence length 186
Comment hypothetical protein Tery_1191 [Trichodesmium erythraeum IMS101]
Sequence
MKFGYGNNTSFLNQLEKRSLTYIGGLAKNRKVIIKKQDDIKEEIRLDKLAESIPQKAFNL
VQLSTKNAREVWVATLEVEISRMSGQKTIAIVMNAKSFSEATDINYYITNREDKYVTPEW
IYSTYSQRNWVEVFYREAKGWLGLREYQVRDKISLKRHFILVFCAYTFIIWHQLTGGIRG
VGLTNH
Download sequence
Identical sequences Q116M5
203124.Tery_1191 gi|113474961|ref|YP_721022.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]