SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113475124|ref|YP_721185.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113475124|ref|YP_721185.1|
Domain Number 1 Region: 1-181
Classification Level Classification E-value
Superfamily Recombination protein RecR 4.84e-68
Family Recombination protein RecR 0.00000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113475124|ref|YP_721185.1|
Sequence length 182
Comment recombination protein RecR [Trichodesmium erythraeum IMS101]
Sequence
MPGVGPKTAQRLALYIIKRPEAEIQALAEALVDARKKIGLCQKCFHLSAEPICEICRNPQ
RDKEVICVVCDSRDLIALEKTREYKGQYHVLGGVISPMDGIGPEQLSIQPLVRRVSQENI
QEVIIAISPSVEGETTTLYVGQLLRPFTKVTRIAFGLPMGGDLEYADELTLARALEGRQE
LE
Download sequence
Identical sequences Q115W2
203124.Tery_1416 gi|113475124|ref|YP_721185.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]