SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113475175|ref|YP_721236.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113475175|ref|YP_721236.1|
Domain Number 1 Region: 116-303
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.56e-48
Family BC ATP-binding domain-like 0.00021
Further Details:      
 
Domain Number 2 Region: 16-112
Classification Level Classification E-value
Superfamily PreATP-grasp domain 4.03e-23
Family BC N-terminal domain-like 0.008
Further Details:      
 
Domain Number 3 Region: 308-365
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 0.0000000000000863
Family BC C-terminal domain-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113475175|ref|YP_721236.1|
Sequence length 386
Comment phosphoribosylaminoimidazole carboxylase ATPase subunit [Trichodesmium erythraeum IMS101]
Sequence
MVKMKMNEEEKKQQNKIQRVGVVGGGQLAWMMGDAAKKLGVDLIIQTPHQDDPAVSIAKD
IILAEIDDPQATTKLANICDVITFENEFINIDELSYLAEKNVIFRPSLSVLKPLLDKYEQ
LCYLRYLGLPVPNFWEWGIEIEPLSFPLVLKARRHGYDGQGTFIIKNIESLKSQGNSEFF
IQEFIPFEREVAVIAARGVTGEVKVYPVVETQQENQVCQRVFVPDENLELVTEIEEIAQT
LLNSLEVVGVFGIEMFITKDKKVLINEIAPRTHNSGHYSLDACEVSQFEQHLRAVCGLPL
GNTTLKVRRAVMVNLLGYEFGENYYLTKRQMLEKIPHASVWWYGKTESRPGRKLGHVTVL
LDEENFEIMGRKGEAIANKIENIWYT
Download sequence
Identical sequences Q115R1
gi|113475175|ref|YP_721236.1| 203124.Tery_1473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]