SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113475234|ref|YP_721295.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113475234|ref|YP_721295.1|
Domain Number 1 Region: 302-497
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.56e-48
Family Ribonuclease PH domain 1-like 0.00000846
Further Details:      
 
Domain Number 2 Region: 4-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.67e-42
Family Ribonuclease PH domain 1-like 0.0000267
Further Details:      
 
Domain Number 3 Region: 143-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.27e-27
Family Ribonuclease PH domain 2-like 0.0021
Further Details:      
 
Domain Number 4 Region: 460-558
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.38e-26
Family Ribonuclease PH domain 2-like 0.0001
Further Details:      
 
Domain Number 5 Region: 566-650
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.53e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0027
Further Details:      
 
Domain Number 6 Region: 628-706
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.04e-17
Family Cold shock DNA-binding domain-like 0.00049
Further Details:      
 
Domain Number 7 Region: 236-329
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000000759
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113475234|ref|YP_721295.1|
Sequence length 717
Comment polynucleotide phosphorylase/polyadenylase [Trichodesmium erythraeum IMS101]
Sequence
MEEIDKSISFDGRDIRLKVGLFAPQAGGAVMIESGDTAVLVTATTAKGREGIDFLPLLVD
YEERLYAGGKIPGGFLRREGRPPEKVTLTSRLIDRPLRPLFPSWLRDDIQIVATTLSMDE
EVPPDVLAVTGSSVAVLLAKLPFYGPMAAVRVGLVGDDFIINPTYREVKNGDLDLVVAGS
PQGVIMVEAGANQLPEQDIIEAIDFGYEAVCDLIQAQREIIAEMGIELVELEPPEVDPTL
ENYIKEKATEQIKEILSQYDLDKNQRDEKLDEIKDSLAESITELPEEEAVRAMVESESML
LGNAFKSVTKKLMRQQIVAEGIRVDGRKLDEVRPVSCRVGVLPSRVHGSSLFNRGLTQVM
SAVTLGTPGDAQELADDLHPQDEKRYLHHYNFPPFSVGETKPLRQPGRREIGHGALAERA
LIPVIPKSDIFPYVIRVVSEVLSSNGSTSMGSVCASTLGLMDAGVPIVKPVSGAAMGLIK
EDEEVRILTDIQGIEDFLGDMDFKVAGTDSGITALQMDMKITGLPIEVIADAIHQAKPAR
IHILDKMLSVLDLPRPDMSPYAPRLLSFKIDPEMIGLVIGPGGKTIKGITEETGVKIDID
DDGTVTIAAADGEKAKQACNIIQGMTKKLNPGDVYVGRVTRIIPIGAFVEVFAGKEGMVH
ISQIADYRVGKVEDELAIGDEVIVKVREIDSKGRVNLTRLNIHPDEAAAARANAMNY
Download sequence
Identical sequences Q115K2
gi|113475234|ref|YP_721295.1| 203124.Tery_1541 WP_011611198.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]