SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113475260|ref|YP_721321.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113475260|ref|YP_721321.1|
Domain Number 1 Region: 585-815
Classification Level Classification E-value
Superfamily C-type lectin-like 2.83e-77
Family Sulfatase-modifying factor-like 0.00017
Further Details:      
 
Domain Number 2 Region: 296-535
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 4.18e-46
Family Protein prenylyltransferase 0.022
Further Details:      
 
Domain Number 3 Region: 70-227
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.43e-23
Family Prokaryotic proteases 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113475260|ref|YP_721321.1|
Sequence length 820
Comment hypothetical protein Tery_1568 [Trichodesmium erythraeum IMS101]
Sequence
MKYTIKFTMLLTTLTLVSCDKIPFMNKQLSQPEKLTFVAKKSGTPKNYSALNRLAQQTMV
EIVSEGYLVGDDKYILKGSGVIIGRKDFVYYVLTANHIFNMNDIFYVFIRSKKLGKAGEV
TGLKFINRYPQEDLALIAFASFTNYRVMELGDVSQLDDNNQVYVAGWPGYDNRENFQFTR
AKVTNSQMGNNLTYKPIELENGLYKGMSGGAVLNEAGQLVGIHLGLTKVDEDREGVLIST
FLRMVSPEVKDILERPTFLIILQAFVLLLLACFFFIVFDQYVYPWKKIWKKKKTSVAILP
LPTREDQTITKFLIQNAESYFNQGLKYRNQRKYDLAIAEFNQAIKLNPKYAEAYYNRGNV
YNTQGKYDLALVDYNQAIKFNPKYTQVYNNKGIIYNKQGKYDLALAEFNQAIKLNPKYSK
VYNNRGIVYNNQRKYDLAIAEFNQAIKLNPKYAEAYYNRGNIYNNQGKYDLALAEFNQAI
KFKPKYAKAYYNRGLVYKTQRNIERVISDFEKAAKLYKEQQNQRWYQNSLDKLKKLQYIY
SEQEKSEKGQVFTFEVVRLNNSGNIISRTQGRAQQKIEHLGNDIKLEIVYIPGGSFLMGS
PTEEVGRYSDEGPQHRVTLQPFYMSKYPITQDQYQVIMGNNPSRFRGGRCPVETVSWHDA
TEFCEKLSQKTGRDYRLPSESQWEYACRAGTTTPFYFGETITPDFANYYGNSSYGNGPKG
KYRQQTTYVGIFPPNAFGLYDMHGNVWEWCADEWHDNYDGAPTDGSVWLDGNKNRSPLRG
GSWVYCPYYCRSAIRSLFLPRDVHNYDFGFRVVCNSRRTF
Download sequence
Identical sequences Q115H6
WP_011611224.1.43450 203124.Tery_1568 gi|113475260|ref|YP_721321.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]