SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113475275|ref|YP_721336.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113475275|ref|YP_721336.1|
Domain Number 1 Region: 30-268
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.06e-63
Family Alanine racemase-like, N-terminal domain 0.0000175
Further Details:      
 
Domain Number 2 Region: 261-394
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 2.41e-47
Family Alanine racemase 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113475275|ref|YP_721336.1|
Sequence length 395
Comment alanine racemase [Trichodesmium erythraeum IMS101]
Sequence
MLSREKTSFKTLALESDAYGGICQRAWVEINDRALSYNVQQLKSLLSAKTQLMGVVKADA
YGHGASKISKTILEAGVDRLAVATLPEGIELRLAGIKPPILILGAIDRPEQIRAIAHWQL
EPTICTPQQALVFSETLSYQTEPMLVHLKLDTGMSRLGTPWQQAVEFVKFVQGLPNLKIA
SIYSHLATADNLDQTVMKQQHQRFEEAIGLCGIGGKSFSSDIQLHLANSAATLTDPALHY
DMVRVGLAIYGLYPAPHLQDKINLKPVMQVKARVTQVKTIEAGTGVSYGYQFIAPKQMRL
AVVGIGYADGLPRNLSNRMKVIVRDRLIPQVGAITMDQLMLDVSAIPDLETGEVVTLLGQ
VGKHQISAENWANTLGTISWEILCGFKNRLPRVAV
Download sequence
Identical sequences Q115G1
WP_011611239.1.43450 gi|113475275|ref|YP_721336.1| 203124.Tery_1583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]