SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113475381|ref|YP_721442.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113475381|ref|YP_721442.1|
Domain Number 1 Region: 4-227,419-662
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 3.52e-150
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000000648
Further Details:      
 
Domain Number 2 Region: 227-418
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 2.51e-56
Family ValRS/IleRS/LeuRS editing domain 0.00000185
Further Details:      
 
Domain Number 3 Region: 763-928
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 2.24e-35
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113475381|ref|YP_721442.1|
Sequence length 929
Comment leucyl-tRNA synthetase [Trichodesmium erythraeum IMS101]
Sequence
MDSKYNPVSIEQKWQKNWAEQNQDQTPINNNQPKFYALSMFPYPSGNLHMGHVRNYTITD
VIARLKRMQGYRVLHPMGWDAFGLPAENAAIDRGIPPAKWTLENIAQMKEQLRRLGFSID
WDKEVATCTPEYYRWTQWIFLQFFQAGLAYQKESAVNWDPIDQTVLANEQVDGEGRSWRS
GAKVERKMLRQWFFKITDYAEQLLNDLDKLPGWPERVKLMQANWIGKSVGAYLEFPIVGM
DQKIGVFTTRPDTVYGVSYVVLAPEHPLTAKVTTPEQQITVETFIKEVAAESELERTAED
KPKRGVPTGGKAINPFNNQEVPIWIADYVLYEYGTGAVMGVPAHDVRDFQFAKQYNLPIK
TVIVPDDSNDDHKLTEAYTDVGVMVNSGPFNGEKSTVAKKAIIELAEDEGYGKGRVQYRL
RDWLISRQRYWGAPIPIIHCPKCGAVPVPDEDLPVKLPESVEFSGRGPSPLAKLEDWVNV
SCPSCGTPAKRETDTMDTFIDSSWYYLRYPDATNEEQVFDSKIVNDWLPVDQYVGGIEHA
ILHLLYSRFFTKVLRDRGLCDFDEPFQNLLTQGMVQGVTYKNPVTGKYIPFADVNPQEPK
DPKTGDKLEVFFEKMSKSKYNGVDPMDVMATYGADTARMFILFKAPPEKDLEWDDADVQG
QFRFLNRVWSMVMEFLANHSFSELKAKHHGITQADLKDLGWSRYLITEITKNISAFKLRN
VVKVYPVEDVLVAIEAKFNYSETQQETKDDLQKVLTWIKSRFGGELTKAEKDVRRAVHNA
IKEVTEDLDGDYQFNTAVSEMMKLSNALGDASCKDSPIYAEALETLLLLLAPFAPHITEE
LWQIAGNFGSVHTHAWPKFDPEALVVDEITLVIQIKGKTRGTIQVPAQADKETLEKLARE
SDIAQRHLAGKEIKKVIVVPRKLVNFVVI
Download sequence
Identical sequences Q114V5
203124.Tery_1704 gi|113475381|ref|YP_721442.1| WP_011611344.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]