SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113475503|ref|YP_721564.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113475503|ref|YP_721564.1|
Domain Number 1 Region: 380-570
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.66e-18
Family Serralysin-like metalloprotease, catalytic (N-terminal) domain 0.053
Further Details:      
 
Domain Number 2 Region: 127-234
Classification Level Classification E-value
Superfamily Collagen-binding domain 2.62e-16
Family Collagen-binding domain 0.0032
Further Details:      
 
Domain Number 3 Region: 243-347
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000000000523
Family Collagen-binding domain 0.0038
Further Details:      
 
Weak hits

Sequence:  gi|113475503|ref|YP_721564.1|
Domain Number - Region: 593-787
Classification Level Classification E-value
Superfamily Sialidases 0.0687
Family Endo-alpha-sialidase 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113475503|ref|YP_721564.1|
Sequence length 2062
Comment peptidyl-Asp metallopeptidase [Trichodesmium erythraeum IMS101]
Sequence
MDPISEELNNFRQGFTFTGTGEVLAEVDKFGDELRFSSGLELSPASEELKIENIDTSNAD
ENFLLPKSNLGNLDLNIEDSEDRTLKTETDPLIGQDNDPVQEVDSLISGTSDRVNNIQTR
AAKKRDKAGNSRGKAHNLGVLEDDQKLQEFVGKSDRKDFYKFKVKNKTDIDIELGGLSGN
ADLYLLNNRGKVIEKSNKGGKRAEDIERTLNPGTYYVRVQSKGRANANYNLSLDSELSDL
AGNSLKRAHNLGVLKDDQKFQEFVGKSDRKDIYKFKVKDKTDVDIELGGLSGNADLYLLN
NRGKVIEKSTKGGKRVEDVDRTLNPGTYYVRVQSRNKRVNADYSLSLDTKSPHLHIHEPI
IINAIDTAADQPGTLDDSSTIDLMVVYTSEARRAEGGIDAIKDLIEFAVDDANEAFAKSG
VQSQLRLVHTAEVNYTESGKSIKELERLKNDSDGYMDEVHELRNDYGADIVSLFVSSLDD
AGGIAYPMGTPAYQFESHAFNVVTNYNAKTRHTLAHEIGHNLGLAHDRDNAEGQGSFPYG
YGYTTPSGAGTIMSYARNRLPYFSNPAISYNGEALGQTNRENSALAINKVAQYAANWRPS
GGTIKSQDSITLNSPNGGNTLEQGSNYTITWNDNISENIKLELYKGGSFYSTINSSTTSD
GSYSWSIPTSITSGSDYKLKISSVSDSSLYDYSDSNFTIEPEEFITLTAPNGGNSLEPGR
SYYIDWEDNISENVKLELYKGGSFYSTINSSTSSDGRYNIWTVPTSITSGSDYKIKISSV
SDSGLYDYSDSNFTIEPEEFITVTAPNGGNSLEPGISYYLDWEDNIGENVKIELYKGGSF
YSTIDSSTSSDGRHIWGVPTSITSGSDYKIKITSVSDSGLYDYSDSNFTIEPEEFITLTS
PNGGNSLEPGRSYYIDWEDNISENVKLELYKGGSFYSTINSSTSSDGRYNIWTVPTSISS
GSDYKIKISSVSDSSLYDYSDSNFTIEPEEFITLTAPNGGNSLEPGRSYYIDWEDNISEN
VKLELYKGGSFYSTINSSTSSDGRYNIWTVPTSITSGSDYKIKISSVSDSGLYDYSDSNF
TIEPEEFITLTAPNGGNSLEPGRSYYIDWEDNISENVKLELYKGGSFYSTINSSTSSDGR
YNIWTVPTSITSGSDYKIKISSVSDSGLYDYSDSNFTIEPEEFITLTAPNGGNSLEPGRS
YYIDWEDNISENVKLELYKGGSFYSTINSSTSSDGRYNIWTVPTSITSGSDYKIKISSVS
DSGLYDYSDSNFTIEPEEFITLTSPNGGNSLEPGRSYYIDWEDNISENVKLELYKGGSFY
STINSSTSSDGRYNIWTVPTSITSGSDYKIKISSVSDSGLYDYSDSNFTIEPEEFITLTA
PNGGNSLEPGRSYYIDWEDNISENVKLELYKGGSFYSTINSSTSSDGRYNIWTVPTSITS
GSDYKIKISSVSDSGLYDYSDSNFTIEPEEFITLTAPNGGNSLEPGRSYYIDWEDNISEN
VKLELYKGGSFYSTINSSTSSDGRYNIWTVPTSITSGSDYKIKISSVSDSGLYDYSDSNF
TIEPEEFITLTAPNGGNSLEPGRSYYIDWEDNISENVKLELYKGGSFYSTINSSTSSDGR
YNIWTVPTSITSGSDYKIKISSVSDSGLYDYSDSNFTIEPEEFITVTAPNGGNSLEPGIS
YYLDWEDNIGENVKIELYKGGSFYSTIDSSTSSDGRHIWGVPTSITSGSDYKIKISSVSD
SGLYDYSDSNFTIEPEEFITVTAPNGGNSLEPGISYYLDWEDNIGENVKIELYKGGSFYS
TIDSSTSSDGRHIWGVPTSITSGSDYKIKISSVSDSGLYDYSDSNFTIEPEEFITVTAPN
GGNSLEPGISYYLDWEDNIGENVKLELYKGGSFYSTINSSTSSDGRYTWLVPTSITSGSD
YKIKITSVSDSGLYDYSDSNFTIEADDSNSDKYYFTYFYDLGDSYDGFLYEKAGRYSLDD
SLYSSNGRYQIWDIESGVGSKNDIGDVYVYSYYDENYTGETYEPSWWTWGLTAGENGLGS
ESDTISGFYGEEYFDPYNEADG
Download sequence
Identical sequences Q114I3
WP_011611466.1.43450 gi|113475503|ref|YP_721564.1| 203124.Tery_1835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]