SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113475505|ref|YP_721566.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113475505|ref|YP_721566.1|
Domain Number 1 Region: 180-640
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.42e-116
Family Amylase, catalytic domain 0.0000000047
Further Details:      
 
Domain Number 2 Region: 648-751
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 7.09e-37
Family alpha-Amylases, C-terminal beta-sheet domain 0.00033
Further Details:      
 
Domain Number 3 Region: 14-114
Classification Level Classification E-value
Superfamily E set domains 8.05e-17
Family E-set domains of sugar-utilizing enzymes 0.0082
Further Details:      
 
Domain Number 4 Region: 138-195
Classification Level Classification E-value
Superfamily E set domains 0.0000000406
Family E-set domains of sugar-utilizing enzymes 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113475505|ref|YP_721566.1|
Sequence length 776
Comment glycogen branching protein [Trichodesmium erythraeum IMS101]
Sequence
MTISADQVNQIAWNHHHDPFQVLGSHQIELSGKTMTVIRAYQPSAEAVSVISPIDRKEYP
MQSVHNPHFFECVINTPKLANYQLKIKEGEHERVIHDPYAFRSAKLTEFDLQLFGEGNHH
RIYEKLGAHITEVDGIKGVYFAVWAPNARNVSILGNFNYWDGRKHQMRKGHTGVWELFIP
DIGPGESYKYEVKNWEGHIYEKSDPYGYQQEVRPKTASIVVDLDSYTWNDQEWMEKRRHT
DPLTQPISVYECHFGSWIHASAHEPAKLPNGETEPVVQVSELRPDARFLTYRELADRLVS
YVKDLGYTHIEMLPVAEHPFDGSWGYQVTGFFAPTSRYGSAQDFMYFVDKCHENGIGVIV
DWVPGHFPKDGHGLAFFDGTHLYEHPDPRKGEHKQWGTLVFDYGRNEVRNFLAANALFWF
DKYHIDGVRVDAVASMVYHNYMRPDGEWVANKYGGVEYIEAADFLRQVNHLLFSYYPGVL
SIAEESTSWPMVTWPTYVGGLGFNFKWNMGWMHDMLDYFEMDPWFRQFHQNNVTFSIWYH
HTENYMLALSHDEVVHCKSSILGKMPGDNWQKFANVRALFAYMFTHPGKKTMFMGMELPQ
WGEWDVWGDLEWHLLEFDAHQGMKRFFRDLNHLYCSEPALYEQDCNEGGFEWIDCNDNNH
SVVSFIRRAKDGKDFVVTVCNFTPQPHSHYRVGVPEPGFYTEIFNSDAGNYGGSNMGNLG
GKWTDDWFFHDYQQSLDLCLPPLGVVVFQLDKKKTIAMIQESEDVETVEAKAKNAS
Download sequence
Identical sequences Q114I1
203124.Tery_1837 gi|113475505|ref|YP_721566.1| WP_011611468.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]