SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113475532|ref|YP_721593.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113475532|ref|YP_721593.1|
Domain Number 1 Region: 220-365
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 9.81e-45
Family ATP-dependent riboflavin kinase-like 0.00028
Further Details:      
 
Domain Number 2 Region: 91-224
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 5.63e-22
Family Adenylyltransferase 0.01
Further Details:      
 
Weak hits

Sequence:  gi|113475532|ref|YP_721593.1|
Domain Number - Region: 13-47
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 0.000139
Family Adenylyltransferase 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113475532|ref|YP_721593.1|
Sequence length 368
Comment bifunctional riboflavin kinase/FMN adenylyltransferase [Trichodesmium erythraeum IMS101]
Sequence
MWITSSLATALTPTAVALGNFDGLHQGHRQVIEPILNLKGRSKLLSVCPSELTRTTEVDE
DTKLKLWHQDSKLSSWHFENELGKNDDYLRQKIYSTVVTFNPHPQEFFSGKPKKLLAPLE
EKLAIFKHIGVEQVVLLPFDRNLADLTPNKFVEEILVKGLQVHQISVGCDFCFGQKRAGK
AKDLQAIAGYYDIDVTTVPLYHSENGERISSSIIRQALEKGDLDKSNRLLGRPYSLIGEV
VHGQQLGRTLGFPTANLQLAAQKFLPRFGVYAVEVYLSRQKQPQEILHAESPYLGVMNVG
CRPTLNSLDPTVEVHLLDMSQDLYGQTLTVNLIEFLRPEQKFASLDLLKAQIYEDCRIAR
SILKNQTI
Download sequence
Identical sequences Q114F4
203124.Tery_1864 gi|113475532|ref|YP_721593.1| WP_011611493.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]