SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113475544|ref|YP_721605.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113475544|ref|YP_721605.1|
Domain Number 1 Region: 1-161,259-373
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 5.42e-83
Family Glutathionylspermidine synthase ATP-binding domain-like 0.00039
Further Details:      
 
Domain Number 2 Region: 165-272
Classification Level Classification E-value
Superfamily PreATP-grasp domain 5.47e-39
Family Glutathionylspermidine synthase substrate-binding domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113475544|ref|YP_721605.1|
Sequence length 375
Comment glutathionylspermidine synthase [Trichodesmium erythraeum IMS101]
Sequence
MKRINIEPRANWQQKCEAVGFHFYNMYSQPYWYESACYHFSTSEINELEVATNALQELYI
EAAELIIQEDRFSQLCIPPEFVELCRQSWERDDPSLYGRFDLAYDGINPPKLLEYNADTP
TALLETSVVQWTWLEEIFPEADQFNSVHEKLLASFLEMNGLGGETLYFSCERETLEDLGT
VEYLRDLAIQAGLNTQHIYIDDIGWSEDLEIFCDLDNQIIRHLFKLYPWEWMMGENFGKY
LLLEPMKMIEPAWKLIWSNKAILPILWEFFPDHPNLLPAYFDSSKLSHPYLSKPVFSREG
GNITVYFGDREYQTEGIYENEPVIYQSYYQLPNFDSYYPVVGAWVIGGEAAGICLREDKE
IVTQDLSRFVPHYFT
Download sequence
Identical sequences Q114E2
WP_011611505.1.43450 203124.Tery_1876 gi|113475544|ref|YP_721605.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]