SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113475559|ref|YP_721620.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113475559|ref|YP_721620.1|
Domain Number 1 Region: 822-909
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000000222
Family Collagen-binding domain 0.0045
Further Details:      
 
Domain Number 2 Region: 213-309
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000000327
Family Collagen-binding domain 0.0067
Further Details:      
 
Domain Number 3 Region: 319-428
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000235
Family Collagen-binding domain 0.0079
Further Details:      
 
Domain Number 4 Region: 1060-1154
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000248
Family Collagen-binding domain 0.0052
Further Details:      
 
Domain Number 5 Region: 948-1031
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000183
Family Collagen-binding domain 0.015
Further Details:      
 
Domain Number 6 Region: 587-669
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000275
Family Collagen-binding domain 0.0083
Further Details:      
 
Domain Number 7 Region: 464-544
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000209
Family Collagen-binding domain 0.0031
Further Details:      
 
Domain Number 8 Region: 708-785
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000497
Family Collagen-binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113475559|ref|YP_721620.1|
Sequence length 1156
Comment peptidase-like protein [Trichodesmium erythraeum IMS101]
Sequence
MPETFQVEFSGTWGEAEPGPNPNPKIYPTDPPNTFRWGESVEEDLKPNSLLFNAEDISGG
IKTDQQFEVGKLTFFNGSIFSDTAVESVPLKIELLDPFELLDSPITFTFNLDLDTTEDTS
DEIDDWSDFVYFPKVLPTETFKFDGQTYTLELTGFSQDGGDTLVNRFRVMEQEVDIASLF
AKIRLAPRDIERLEDPTAKTDGAINLGDLNSRKNYRNTDEIGFNEGGVRDLQDFYKFTLS
KDSEVDITLDQLKRNANVEILDEDGSTVLFQSTEENRKRENITENLESGDYFIRVYPEGD
DRTKYRLGVSADALTDEKDTTDTAKELGNIGLEEVTEIDRIGFGRGKNRDQEDYYKFGIN
EKSDFFLTLDQLKGNANVEVLDGDGSTILYQSNNSGRKREKINEELEPGDYFVRVTPQGA
ARTDYRLGLSADVLSNEQDDQEPGISLGAVTELTPVSKTGKLGANKDRVDWYNFSVPIES
DVNLTLDRLRQDLNLEIYDEGGELVDDGKNTGRKAEKIELEGLEPGTYNIKVFPNGGAKS
NYRLGITATAPYVDDYASVEEALDFGNIPIGETRVFNGEMGRTEGRSGRDTEDWVSFTID
EESLVDIDLTRLRQNIDMILYDDDGTFLNNSRNKGRKSENIAEILEAGTYHVQILPKGNS
RSNYRFSVNAEPIPEPRQEFTVGDLLSLEDGYSIRGEEIGFTSGGIRNVIDRHLFSISDE
RNVEIDLTGLKRNANIALYDDDGTLLLESRKGGRRNENISDTLDPGDYYVDVEPQNQAKT
KYNLDIFASGSSVDPDGGPVLETSLYNDIGNLTEDYSKIDNVGFGSGSSRDEVDYYKFEL
SEDKNLTISLNKLSADIDLELLDSSDTLIKDSRNKKKKNEKIEEELEPGTYYVGVEPKGN
ARGNYTLNIKVPEPGSSVDEDGGKLPENVTDIGVLTSYEEEDSIGREENSYRDVNDYRKF
TLSAKSSVDINLTGLTGNANLQLIDGDGSTVLNTSANGGSDDEKINLTLDAGDYCVRVFP
RGAAKTDYTLNMSASEIGESIDNEPPGIALGTVTVGADPLTQGGDLGFTEGGVVDTKDYY
SFDITQAGFVDIKLDDLSDNADLKLYDETGEVELGSSNNSGNTSEEINSFLSADTTYVVG
VFGLGNQTPYDLSISL
Download sequence
Identical sequences Q114C7
gi|113475559|ref|YP_721620.1| WP_011611520.1.43450 203124.Tery_1891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]