SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113475560|ref|YP_721621.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113475560|ref|YP_721621.1|
Domain Number 1 Region: 397-480
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000000000235
Family Collagen-binding domain 0.01
Further Details:      
 
Domain Number 2 Region: 144-229
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000549
Family Collagen-binding domain 0.0086
Further Details:      
 
Domain Number 3 Region: 20-114
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000654
Family Collagen-binding domain 0.0052
Further Details:      
 
Domain Number 4 Region: 770-854
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000589
Family Collagen-binding domain 0.01
Further Details:      
 
Domain Number 5 Region: 497-595
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000484
Family Collagen-binding domain 0.01
Further Details:      
 
Domain Number 6 Region: 631-712
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000183
Family Collagen-binding domain 0.021
Further Details:      
 
Domain Number 7 Region: 264-357
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000068
Family Collagen-binding domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113475560|ref|YP_721621.1|
Sequence length 863
Comment peptidase-like protein [Trichodesmium erythraeum IMS101]
Sequence
MANDTRADALDLGVIELEPTVTNDQIGFRVDGKRERNDFYKFKLDEESDFNLTLDKLDKN
ANVQILDSDGSVLFKSTKPGKQREVIDAELDAGEYFVRVLPKGMAQTDYRLSLNADPITD
DELPGVSLGVLDSEEEVTFTDEIGFAKGGQRDKNDYFNFTLDQDSDVSLTLDQLKKNANV
QIWDDKGKTLLLQSRNKGRQEETINAILEKGDYLVRVFPQGRARTSYRLGLSADEILPPE
KLPGTDVGDLLASEEPHFAIEDIGFGRGRQRNTKDYYTFELSQEASFYAELDQLQRNADI
YLYEYDPDEPEELGSRLNKSTRKGRRPDTISEFLPEGHYALEVRPRGAAKTDYRLELDAR
INVDDFPAPEMAKDLGELVPTPTNETGNNVGLLTDDRFRDQADWFKFTLSAEKNVDLTLD
ELRVNAADAEIYDADGTTRLYKSKNKGKQRETINENLDAGTYYVKVVARGSSNTNYRLSL
SADEPISPTDTFPLGTLESPTEYSNNDKIGGEGGGVRNSQDEYTFTINELTEFNATLDQI
KRNVDLELYKGSMLVDSSKEKRNNPEIIDQVLEPGDYTLRVMPMGNAETTYRLGIDTEVV
AEGDETFEVGSLLDLNNNEYKKKGRIGDFQNGSRNLNDFYNLTLDNNSNFMLTLDEMTRD
ANVMVLDSEGDMVLSGFNPENAPEILSDTLDAGDYTVQVFPVGNAKTSYFLKMNADPLPD
PPDDMDDGDDDDMGDDGDETEVDPITGDPDGTPEDATDLGSDLLTQSGKIGFMEDGVDDV
NDYYKFTLDANDDIRIILSGLTQNADLTLLGSDGETEIFTEIFKSSNPGTNTERINATLE
AGDYYLQVEAVGDAQSDYTINFF
Download sequence
Identical sequences Q114C6
gi|113475560|ref|YP_721621.1| WP_011611521.1.43450 203124.Tery_1892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]