SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113475562|ref|YP_721623.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113475562|ref|YP_721623.1|
Domain Number 1 Region: 135-471,500-570
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.49e-130
Family Amylase, catalytic domain 0.000000478
Further Details:      
 
Domain Number 2 Region: 7-148
Classification Level Classification E-value
Superfamily E set domains 5.32e-42
Family E-set domains of sugar-utilizing enzymes 0.0039
Further Details:      
 
Domain Number 3 Region: 602-702
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 6.91e-23
Family alpha-Amylases, C-terminal beta-sheet domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113475562|ref|YP_721623.1|
Sequence length 705
Comment glycogen debranching protein GlgX [Trichodesmium erythraeum IMS101]
Sequence
MNLNILPGNTFPIGATVCQDPKGVNFSIYSKNATAIELLLFDEPLAAKPKQVILLDPTQH
RTHHYWHIFISGIGAGQIYAYRVYGPFNPEKGHRFDGTKVLLDPYARIVVGQEKYSRKAA
TGNGNNCAYALKGVVVDPTTYDWEDDKPLETPYAKTVIYEMHVGGFTRHPNSGVAPEKRG
TFAGLIEKIPYLKELGITAVELLPVQQFDEQDVREPLINYWGYSQIAFFAPHHSYSSRKD
IFGPMDEFRDMVKALHKEGIEVILDVVFNHTAEGNENGPTVSFRGLENSTYYILEKNDRG
YYSNYTGCGNTFNTNNPFVHRLIVDCLCYWVREMHVDGFRFDLASVMSRSMTGDPLEDPP
VLWAIESDPVLAGTKIIAEAWDAAGLYQVGSFIGDRFAEWNGHYRDDVRQFVKSDPQIVE
KLAARIMGSPDIYPKPDREPNHSINFITCHDGFTMNDLVSYNEKHNEANCEDNRDGANHN
FSWNCGIEGTTDQEEIEMLRLRQIKNFFTILFFSQGTPMILMGDEVRRTQLGNNNSYCQN
NKSSWFDWSQIDQQNDLLRFVKKIIHFTQELQITQLDKVLATVGAIPESSLVSTKEKTNL
NKVPNISWHGIHLGIPDWNVGSRTLAFSLKHPESGEYFHIMLNAYWKPLMFELPPLERGE
NWYLIVNTAFTSPKDFNNLDVATKVIGVRYRLEPRAAVILMTKRD
Download sequence
Identical sequences Q114C4
gi|113475562|ref|YP_721623.1| WP_011611523.1.43450 203124.Tery_1895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]