SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113475595|ref|YP_721656.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113475595|ref|YP_721656.1|
Domain Number 1 Region: 355-537
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.56e-63
Family Pyruvate oxidase and decarboxylase PP module 0.0000277
Further Details:      
 
Domain Number 2 Region: 1-170
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.28e-53
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000206
Further Details:      
 
Domain Number 3 Region: 183-360
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 4.43e-40
Family Pyruvate oxidase and decarboxylase, middle domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113475595|ref|YP_721656.1|
Sequence length 545
Comment acetolactate synthase [Trichodesmium erythraeum IMS101]
Sequence
MNTAELLIKCLENEGVKYIFGLPGEENLNILEALKNSSIQFITTRHEQGAAFMADVYGRL
TGKAGVCLSTLGPGATNLMTGVADANLDGAPLVAITGQVGTDRMHIESHQYLDLVAMFSP
VTKWNAQILRPSNTPEIVRKAFKVAQQEKPGAIHIDLPENIAAMSVEGKPLKQDKREKSY
SAYQSMTEAAVAISKAKNPMILVGNGALRGNASEIVTEFATRLNIPVANTFMGKGVIPYT
HPLSLWTTGLQQRDFITCAFEQTDLVIAVGYDLIEYSPKKWNPQGKIPVIHVGAKYAEID
SSYIPIAEIVGDISDSLNEILRRSERINQLSPTVSEIRKSMRYEYEGHGKDDGFPIKPQK
LIYDLRQVMGPEDIVISDVGAHKMWIARHYHCERPNTCLISNGFAAMGIAIPGAIAAKLV
YPERKVVAATGDGGFMMNCQELETALRVGTNFVTLIFNDGGYGLIEWKQENHFGESSFIK
FGNPDFVKFAESFGLKGYRVESAADLIPTLKEALAQDVPAVIDCPIDYRENSRFSQKSGG
LNCSV
Download sequence
Identical sequences Q113Z1
203124.Tery_1928 WP_011611556.1.43450 gi|113475595|ref|YP_721656.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]